|
US$279.00 ยท In stock
Delivery: <= 3 days. True-PDF full-copy in English will be manually translated and delivered via email.
YS/T 538-2016: Fe-Cr-B-Si self-fluxing alloyed powders YS/T 538: Evolution and historical versions
| Standard ID | Contents [version] | USD | STEP2 | [PDF] delivered in | Standard Title (Description) | Status | PDF |
| YS/T 538-2016 | English | 279 |
Add to Cart
|
3 days [Need to translate]
|
Fe-Cr-B-Si self-fluxing alloyed powders
| |
YS/T 538-2016
|
| YS/T 538-2006 | English | 199 |
Add to Cart
|
2 days [Need to translate]
|
Metallic powder material. Self-fluxing Fe-Cr-B-Si alloy powder
| Obsolete |
YS/T 538-2006
|
PDF similar to YS/T 538-2016
Basic data | Standard ID | YS/T 538-2016 (YS/T538-2016) | | Description (Translated English) | Fe-Cr-B-Si self-fluxing alloyed powders | | Sector / Industry | Nonferrous Metallurgy Industry Standard (Recommended) | | Classification of Chinese Standard | H71 | | Word Count Estimation | 8,825 | | Date of Issue | 2016-07-11 | | Date of Implementation | 2017-01-01 | | Older Standard (superseded by this standard) | YS/T 538-2006 | | Regulation (derived from) | Ministry of Industry and Information Technology Bulletin (No.37 of 2016); Industry Standard Record Announcement No.11 of 2016 (No.203) | | Issuing agency(ies) | Ministry of Industry and Information Technology | | Summary | This standard specifies the requirements, test methods, inspection rules and signs, packaging, transportation, storage, quality certificate and contract (or purchase order) of Fe-Cr-B-Si self-fluxing alloy powder. | YS/T 538-2016: Fe-Cr-B-Si self-fluxing alloyed powders---This is a DRAFT version for illustration, not a final translation. Full copy of true-PDF in English version (including equations, symbols, images, flow-chart, tables, and figures etc.) will be manually/carefully translated upon your order.
Fe-Cr-B-Si self-fluxing alloyed powders
ICS 77.160
H71
People's Republic of China Nonferrous Metals Industry Standard
Replacing YS/T 538-2006
Fe-Cr-B-Si self-fluxing alloy powder
2016-07-11 released
2017-01-01 Implementation
Issued by the Ministry of Industry and Information Technology of the People's Republic of China
Foreword
This standard is drafted in accordance with the rules given in GB/T 1.1-2009.
This standard replaces YS/T 538-2006 "Fe-Cr-B-Si self-fluxing powder". Compared with YS/T 538-2006, this standard is the main
The technical changes are as follows.
--- modified the scope of application of the standard;
--- increase the normative reference documents;
--- Added "laser cladding" terminology;
--- modified the particle size range and requirements;
--- modified the test method;
--- modified inspection rules;
--- increase the contents of the contract (or order).
This standard is proposed by the National Committee for Standardization of Nonferrous Metals (SAC/TC243).
The drafting of this standard. Beijing Mining and Metallurgy Research Institute, Zigong Great Wall Hard Surface Material Co., Ltd.
The main drafters of this standard. Liu Haifei, Lu Zaoping, Hu Dandan, Yu Yueguang, Li Wei, Zhang Deming, Shen Jie.
This standard replaced the previous version of the standard release.
--- GB 8549-1987;
YS/T 538-2006.
Fe-Cr-B-Si self-fluxing alloy powder
1 Scope
This standard specifies the Fe-Cr-B-Si self-fluxing powder requirements, test methods, inspection rules and signs, packaging, transportation, storage, quality
Certificate and contract (or order) content.
This standard applies to oxygen-acetylene flame spray, plasma spray welding, laser cladding with Fe-Cr-B-Si self-fluxing alloy powder.
2 normative reference documents
The following documents are indispensable for the application of this document. For dated references, only the dated edition applies to this article
Pieces. For undated references, the latest edition (including all modifications) applies to this document.
GB/T 223 (all parts) Chemical analysis methods for steel and alloys
Metallic powders - Determination of bulk density - Part 1. Funnel method GB/T 1479.1
GB/T 1480 metal powder dry sieving method for determination of particle size
GB/T 1482 Determination of fluidity of metallic powders Standard funnel method (Hall flow meter)
Method for sampling powder for powder metallurgy GB/T
Iron and steel - Determination of oxygen content - Pulse heating inert gas melting - Infrared absorption method GB/T
Standard Test Method for Temperature Range of Solid - Liquid Phase of YS/T 533 Self - fluxing Alloy Powders
Test method for Rockwell hardness of YS/T 541 metal thermal spray coating
3 terms and definitions
The following terms and definitions apply to this document.
3.1
Self-fluxing alloy powder self-fluxingaloyedpowder
Boron and silicon elements and low melting point, since the deoxidation, and the matrix infiltration of good alloy powder.
3.2
Remelting remelting
Refers to the workpiece surface on the self-melting alloy powder re-melting, so that the coating densification and fusion with the matrix generated by the process.
3.3
Oxygen-acetylene flame sprayed oxygen-acetyleneflamespraywelding
The oxygen-acetylene flame is used as the heat source, and the self-fluxing alloy powder is sprayed onto the surface of the workpiece by molten or semi-molten state after the flame area,
Melting, so that the coating and the substrate fusion welding surface of the strengthening technology.
3.4
Plasma spray welding plasmaspraywelding
Using the plasma arc as the heat source, the alloy powder and the surface of the substrate are rapidly heated and melted and mixed together by the high temperature generated by the plasma arc,
Diffusion, solidification, plasma beam away from the self-cooling, forming a layer of high-performance alloy layer, in order to achieve the surface hardening and hardening of the surfacing
Process.
Tips & Frequently Asked Questions:Question 1: How long will the true-PDF of YS/T 538-2016_English be delivered?Answer: Upon your order, we will start to translate YS/T 538-2016_English as soon as possible, and keep you informed of the progress. The lead time is typically 1 ~ 3 working days. The lengthier the document the longer the lead time. Question 2: Can I share the purchased PDF of YS/T 538-2016_English with my colleagues?Answer: Yes. The purchased PDF of YS/T 538-2016_English will be deemed to be sold to your employer/organization who actually pays for it, including your colleagues and your employer's intranet. Question 3: Does the price include tax/VAT?Answer: Yes. Our tax invoice, downloaded/delivered in 9 seconds, includes all tax/VAT and complies with 100+ countries' tax regulations (tax exempted in 100+ countries) -- See Avoidance of Double Taxation Agreements (DTAs): List of DTAs signed between Singapore and 100+ countriesQuestion 4: Do you accept my currency other than USD?Answer: Yes. If you need your currency to be printed on the invoice, please write an email to [email protected]. In 2 working-hours, we will create a special link for you to pay in any currencies. Otherwise, follow the normal steps: Add to Cart -- Checkout -- Select your currency to pay. Question 5: Should I purchase the latest version YS/T 538-2016?Answer: Yes. Unless special scenarios such as technical constraints or academic study, you should always prioritize to purchase the latest version YS/T 538-2016 even if the enforcement date is in future. Complying with the latest version means that, by default, it also complies with all the earlier versions, technically.
|