YS/T 527-2014 English PDF

US$209.00 · In stock
Delivery: <= 3 days. True-PDF full-copy in English will be manually translated and delivered via email.
YS/T 527-2014: Ni-Cr-B-Si self-fluxing alloyed powders
Status: Valid

YS/T 527: Historical versions

Standard ID	USD	BUY PDF	Lead-Days	Standard Title (Description)	Status
YS/T 527-2014	209	Add to Cart	3 days	Ni-Cr-B-Si self-fluxing alloyed powders	Valid
YS/T 527-2006	199	Add to Cart	2 days	Ni-Cr-B-Si-based self-fluxing powder	Obsolete

Similar standards

GB/T 4295   GB/T 7160   YS/T 798   YS/T 218   YS/T 677   YS/T 528   

Basic data

Standard ID: YS/T 527-2014 (YS/T527-2014)
Description (Translated English): Ni-Cr-B-Si self-fluxing alloyed powders
Sector / Industry: Nonferrous Metallurgy Industry Standard (Recommended)
Classification of Chinese Standard: H71
Classification of International Standard: 77.160
Word Count Estimation: 8,850
Date of Issue: 10/14/2014
Date of Implementation: 4/1/2015
Older Standard (superseded by this standard): YS/T 527-2006
Quoted Standard: GB/T 230.1; GB/T 1480; GB/T 5314; GB/T 21931.1; YS/T 539.1; YS/T 539.3; YS/T 539.4; YS/T 539.6; YS/T 539.13
Regulation (derived from): People's Republic of China Ministry of Industry and Information Technology Notice 2014 No. 63; Industry Standard Filing Notice 2014 No. 12 (Overall No. 180)
Issuing agency(ies): Ministry of Industry and Information Technology
Summary: This Standard specifies the Ni-Cr-B-Si-based self-fluxing powder requirements, test methods, inspection rules and signs, packaging, transportation, storage, quality certificates and contracts (or orders) content. This Standard applies to oxygen - acetylen

YS/T 527-2014: Ni-Cr-B-Si self-fluxing alloyed powders

---This is a DRAFT version for illustration, not a final translation. Full copy of true-PDF in English version (including equations, symbols, images, flow-chart, tables, and figures etc.) will be manually/carefully translated upon your order.
Ni-Cr-B-Si self-fluxing alloyed powders ICS 77.160 H71 People's Republic of China Nonferrous Metals Industry Standard Replacing YS/T 527-2006 Ni-Cr-B-Si-based self-fluxing powder Issued on. 2014-10-14 2015-04-01 implementation Ministry of Industry and Information Technology of the People's Republic of China released

Foreword

This standard is in accordance with GB/T 1.1-2009 given rules drafted. Instead of the standard YS/T 527-2006 "Ni-Cr-B-Si-based self-fluxing powder." This standard YS/T 527-2006 compared to major Technical changes are as follows. --- Increasing the scope of the standard; --- Added "induction remelting" "plasma surfacing" and "laser cladding" term; --- Modified grades that way; --- Modify the chemical composition of the product; --- Modify the powder particle size range and requirements; --- Revised inspection rules; --- Increasing the contract (or purchase order) content. This standard by the national non-ferrous metals Standardization Technical Committee (SAC/TC243) centralized. This standard was drafted. Beijing Mining Research Institute, Ltd. Zigong Great Wall hardfacing materials. The main drafters of this standard. Liuhai Fei, Zhou Heng, Lu in the flat, in the moonlight, Zhang Deming, Li Xi, Li Wei, Shen Jie. This standard replaces the standards previously issued as follows. --- GB 5316-1985; --- YS/T 527-2006. Ni-Cr-B-Si-based self-fluxing powder

1 Scope

This standard specifies the Ni-Cr-B-Si-based self-fluxing powder requirements, test methods, inspection rules and signs, packaging, transportation, storage, quality Certificates and contracts (or orders) content. This standard applies to oxygen - acetylene welding, induction remelting, plasma welding and laser cladding with Ni-Cr-B-Si-based self-fluxing powder.

2 Normative references

The following documents for the application of this document is essential. For dated references, only the dated version suitable for use herein Member. For undated references, the latest edition (including any amendments) applies to this document. GB/T 230.1 metallic materials - Rockwell hardness test - Part 1. Test methods (A, B, C, D, E, F, G, H, K, N, T standard ruler) Determination of particle size GB/T 1480 metal powder dry sieving GB/T 5314 sampling powder metallurgy method 21931.1 Determination of nickel, GB/T ferronickel and nickel alloys carbon content of the high-frequency combustion infrared absorption method YS/T 539.1 nickel-based alloy powder chemical analysis methods - Part 1. Determination of the amount of boron in acid-base titration and titration The amount of boron YS/T 539.3 nickel-based alloy powder chemical analysis - Part 3. Determination of silicon content of perchloric acid dehydration gravimetric method YS/T 539.4 nickel-based alloy powder chemical analysis - Part 4. Determination of chromium content of ammonium persulfate oxidation titration YS/T 539.6 nickel-based alloy powder chemical analysis - Part 6. Determination of iron titanium trichloride - potassium dichromate titration YS/T 539.13 nickel-based alloy powder chemical analysis - Part 13. Determination of oxygen pulse heating inert gas fusion - infrared absorption Income method

3 Terms and Definitions

The following terms and definitions apply to this document. 3.1 Self-fluxing alloy powder self-fluxingaloyedpowder Boron and silicon element and a low melting point, good self-deoxy-alloy powder, and matrix invasion. 3.2 Oxygen - acetylene flame spray oxygen-acetyleneflamespraywelding Oxygen - acetylene flame as the heat source, the self-fluxing alloy powder after the flame zone in a molten or semi-molten state is sprayed onto the surface, or to re Melt the coating and the substrate to produce fusion bonded surface hardening technology. 3.3 Induction remelting inductionremelting Induction heating coating remelting method. 3.4 Plasma surfacing plasmawelding In plasma arc as heat source, the use of plasma arc generated by the high-temperature alloy powder and the substrate surface quickly heated and melted together, mixed, ......

Image     

Tips & Frequently Asked Questions:

Question 1: How long will the true-PDF of YS/T 527-2014_English be delivered?

Answer: Upon your order, we will start to translate YS/T 527-2014_English as soon as possible, and keep you informed of the progress. The lead time is typically 1 ~ 3 working days. The lengthier the document the longer the lead time.

Question 2: Can I share the purchased PDF of YS/T 527-2014_English with my colleagues?

Answer: Yes. The purchased PDF of YS/T 527-2014_English will be deemed to be sold to your employer/organization who actually pays for it, including your colleagues and your employer's intranet.

Question 3: Does the price include tax/VAT?

Answer: Yes. Our tax invoice, downloaded/delivered in 9 seconds, includes all tax/VAT and complies with 100+ countries' tax regulations (tax exempted in 100+ countries) -- See Avoidance of Double Taxation Agreements (DTAs): List of DTAs signed between Singapore and 100+ countries

Question 4: Do you accept my currency other than USD?

Answer: Yes. If you need your currency to be printed on the invoice, please write an email to Sales@ChineseStandard.net. In 2 working-hours, we will create a special link for you to pay in any currencies. Otherwise, follow the normal steps: Add to Cart -- Checkout -- Select your currency to pay.

Question 5: Should I purchase the latest version YS/T 527-2014?

Answer: Yes. Unless special scenarios such as technical constraints or academic study, you should always prioritize to purchase the latest version YS/T 527-2014 even if the enforcement date is in future. Complying with the latest version means that, by default, it also complies with all the earlier versions, technically.