Home Cart Quotation About-Us
www.ChineseStandard.net
SEARCH

GB/T 36416.2-2018 English PDF

Q: How long will the true-PDF of English version of GB/T 36416.2-2018 be delivered?

Upon your order, we will start to translate GB/T 36416.2-2018_English as soon as possible, and keep you informed of the progress. The lead time is typically 6 ~ 10 working days. The lengthier the document the longer the lead time.

Q: Can I share the purchased PDF of GB/T 36416.2-2018_English with my colleagues?

Yes. The purchased PDF of GB/T 36416.2-2018_English will be deemed to be sold to your employer/organization who actually pays for it, including your colleagues and your employer's intranet.

Q: Does the price include tax/VAT?

Yes. Our tax invoice, downloaded/delivered in 9 seconds, includes all tax/VAT and complies with 100+ countries' tax regulations (tax exempted in 100+ countries). Avoidance of Double Taxation Agreements (DTAs) between Singapore and 100+ Countries: https://www.iras.gov.sg/taxes/international-tax

Q: Do you accept my currency other than USD?

Yes. If you need your currency to be printed on the invoice, please write an email to Sales@ChineseStandard.net. In 2 working-hours, we will create a special link for you to pay in any currencies. Otherwise, follow the normal steps: Add to Cart -- Checkout -- Select your currency to pay.

US$1559.00 · In stock
Delivery: <= 10 days. True-PDF full-copy in English will be manually translated and delivered via email.
GB/T 36416.2-2018: Testing machine vocabulary -- Part 2: Non-destructive testing instruments
Status: Valid

Standard ID	USD	BUY PDF	Lead-Days	Standard Title (Description)	Status
GB/T 36416.2-2018	1559	Add to Cart	10 days	Testing machine vocabulary -- Part 2: Non-destructive testing instruments	Valid

Similar standards

GB/T 17394.3 GB/T 38250 JB/T 8290 GB/T 2611 GB/T 36416.3 GB/T 36416.1

Basic data

Standard ID: GB/T 36416.2-2018 (GB/T36416.2-2018)
Description (Translated English): Testing machine vocabulary -- Part 2: Non-destructive testing instruments
Sector / Industry: National Standard (Recommended)
Classification of Chinese Standard: N70
Classification of International Standard: 19.060
Word Count Estimation: 78,783
Date of Issue: 2018-06-07
Date of Implementation: 2019-01-01
Regulation (derived from): National Standard Announcement No. 9 of 2018
Issuing agency(ies): State Administration for Market Regulation, China National Standardization Administration

GB/T 36416.2-2018: Testing machine vocabulary -- Part 2: Non-destructive testing instruments

---This is a DRAFT version for illustration, not a final translation. Full copy of true-PDF in English version (including equations, symbols, images, flow-chart, tables, and figures etc.) will be manually/carefully translated upon your order.
Testing machine vocabulary--Part 2. Non-destructive testing instruments ICS 19.060 N70 National Standards of People's Republic of China Testing machine vocabulary Part 2. Non-destructive testing equipment Published on.2018-06-07 2019-01-01 implementation State market supervision and administration China National Standardization Administration issued

Content

Foreword I 1 Scope 1 2 Basic concept 1 3 penetration test 1 4 Magnetic particle detection 6 5 Electromagnetic detection 10 6 Ultrasonic testing 16 7 Acoustic emission detection 31 8 ray detection 37 9 leak detection 46 10 infrared detection 48 11 neutron detection 50 Reference 52 Index 53

Foreword

GB/T 36416 "Test Machine Vocabulary" is divided into the following three parts. --- Part 1. Material testing machine; --- Part 2. Non-destructive testing equipment; --- Part 3. Vibration generator system and impact machine. This part is the second part of GB/T 36416. This part is drafted in accordance with the rules given in GB/T 1.1-2009. This part was proposed by the China Machinery Industry Federation. This part is under the jurisdiction of the National Testing Machine Standardization Technical Committee (SAC/TC122). This section drafted by. China Machine Testing Equipment Co., Ltd., Edson (Xiamen) Electronics Co., Ltd., Guangzhou University, Suzhou City, China Testing Technology Co., Ltd., Liaoning Instrument Research Institute Co., Ltd. The main drafters of this section. Liu Zhizhi, Lin Junming, Xu Zhonggen, Chen Hongcheng, Zhu Ping, Yu Zhijun. Testing machine vocabulary Part 2. Non-destructive testing equipment

1 Scope

This part of GB/T 36416 defines the basic concepts, product names, performance parameters, parts, accessories and materials of NDT instruments. Commonly used terms and definitions. This section applies to non-destructive testing instruments, for the development of relevant standards, compilation and publication of various books and literature, as well as domestic and foreign forms. Technical exchange use.

2 basic concepts

2.1 Non-destructive testing and evaluation non-destructivetestingandevaluating NDT Does not destroy the practicability and usability of the test object, inspect and/or evaluate various defects, integrity and composition on the surface and inside, and Detection techniques for measuring some of its physical properties and geometric properties. 2.2 Non-destructive testing instrument non-destructivetestinginstrument An instrument designed for nondestructive testing based on various physical principles such as electromagnetic, ultrasonic, and ray. Currently widely used Magnetic particle flaw detector, eddy current detector, ultrasonic detector, ultrasonic thickness gauge, radiographic flaw detector, infrared detector, leak detector, neutron detector, Acoustic emission detectors and integrated electromagnetic and acoustic instruments. 2.3 Integrated non-destructive tester combinednon-destructivetest An all-in-one instrument capable of simultaneous or time-division detection using two or more non-destructive testing techniques and methods.

3 Penetration testing

3.1 Basic terms 3.1.1 Wetting action The ability of a liquid to expand or adhere to a solid surface. 3.1.2 Capillary [tube] action capilaryaction In osmotic flaw detection, small defects (such as cracks and cracks) in the surface opening are similar to capillary tubes, and the permeate is due to surface tension and adhesion. The phenomenon of the penetration of such defects by the action of force. 3.1.3 Exuding bleedout The penetrant comes out of the discontinuity. [GB/T 12604.3-2013/ISO 12706.2009, definition 2.2] 3.1.4 Sucking blotting The developer accelerates the development of the permeate from the defect to the surface. 3.1.5 Background background The extent to which the fluorescent penetrant or coloring penetrant remains on the surface of the workpiece after removal of excess penetrant. [GB/T 12604.3-2013/ISO 12706.2009, definition 2.1] 3.1.6 Contrast contrast The degree of difference in the visibility of the defect trace after display compared to the visibility (brightness or color) of the background. 3.1.7 Penetrant detection penetranttesting Penetration flaw detection pennerantflawdetection A typical non-destructive test, including infiltration, removal of excess penetrant, development, etc., in order to form a discontinuity in the surface opening See the display. [GB/T 12604.3-2013/ISO 12706.2009, definition 2.20] 3.1.8 Color penetration detection dye-penetranttesting A penetrating flaw of the indicator mark of the defect was observed under visible light irradiation using a coloring permeate. Divided into water according to the nature of the penetrant Washing color penetrating flaw detection method, post-emulsification coloring penetrant flaw detection method, solvent removal coloring penetrant flaw detection method. 3.1.9 Fluorescence penetrant detection fluorescentpenetranttesting A permeation flaw of the defect trace was observed by the excited fluorescence under ultraviolet irradiation using a fluorescent permeate. According to the nature of the penetrant The quality is divided into water-washing fluorescence penetrant detection method, post-emulsification fluorescence penetrant inspection method, and solvent-removing fluorescence penetrant inspection method. 3.1.10 Black light blacklight Ultraviolet radiation < Permeation detection, magnetic particle detection> Ultraviolet light having a wavelength of 320 nm to 400 nm (3200 Å to 4000 Å), that is, UV-A. 3.1.11 Display indication A trace formed by oozing a sufficient amount of permeate from the defect to indicate the presence of the defect. 3.2 Testing equipment 3.2.1 Penetration testing device pennetranttesting unit Equipment used in penetration testing. Usually consists of an osmotic device, an emulsifying device, a display device, a cleaning device, and a drying device. to make. In addition to the above devices, fluorescent infiltration detection is equipped with a black light and a dark room. 3.2.2 Black light blacklightlamp Ultraviolet lamp ultraviolet radiationlamp A device that emits black light in fluorescent penetrant inspection or magnetic particle inspection. High-pressure mercury quartz lamps and controllers with filters, etc. composition. 3.2.3 Black light filter blacklightfilter Ultraviolet filter ultraviolet radiationfilter A filter device that transmits near-ultraviolet radiation while absorbing other wavelengths of radiation. 3.2.4 Pre-cleaning unit precleaning unit Equipment for cleaning and drying the test piece before penetrant testing. Generally, it consists of a degreasing device, a solvent cleaning tank, a flushing spray gun, and the like. 3.2.5 Degreasing unit A device that removes oil and has a degreasing function. Usually the bottom is equipped with a heater, and the upper part is equipped with a serpentine condenser and a supporting test piece. Grille, etc. 3.2.6 Penetrating device penetratingunit A device for dispensing permeate. It usually consists of a drip table and a grid for supporting the test piece. 3.2.7 Emulsifier emulsifierunit A device for spraying emulsion. It is usually made of stainless steel or aluminum alloy plates with a grille and drain holes at the bottom. 3.2.8 Cleaning unit washingunit A device that flushes the test piece. It is usually composed of a nozzle, water pressure regulation, water temperature adjustment, flow regulation, etc., and is equipped with a pressure gauge and temperature. Degree meter, etc. 3.2.9 Drying box dryingoven An oven used to accelerate the rate of evaporation of water and water display agents. An air circulation box usually with a thermostatic control. 3.2.10 Electrostatic spraying device electrostaticsprayingdevice Equipment used in electrostatic spraying. Generally includes electrostatic generator, powder hopper cabinet, high pressure air pump, permeate spray gun, display agent Spray gun and other parts. 3.2.11 Sprayer sprayer A closed pressure vessel. It is filled with a osmotic flaw detector and an aerosol, usually filled in a liquid state, vaporized at room temperature to form a gas. Pressure spray. 3.3 Accessories and materials 3.3.1 Penetrant test agent A general term for a complete series of penetrant testing materials required for penetrant testing. Including penetrants, emulsifiers, cleaning agents, imaging Agents, etc. 3.3.2 Carrier liquid vehicle < Permeation detection, magnetic particle detection> A water quality or non-water liquid capable of dissolving or suspending a penetration test agent. 3.3.3 Penetrant penetrant a liquid applied to the surface of the workpiece that has the ability to enter the discontinuity and remain in the excess after removal Discontinuously detectable performance. It is divided into a water-washing type penetrant, a post-emulsion type penetrant, and a solvent-removing type penetrant. 3.3.4 Fluorescent penetrant A penetrating agent that excites fluorescence under UA-A radiation. [GB/T 12604.3-2013/ISO 12706.2009, definition 2.13] 3.3.5 Coloring penetrant dyecenetent A liquid with a dye (usually red) that is observable under ordinary light. 3.3.6 Dual-purpose penetrant dualpurposepenetrant A penetrant is shown which exhibits both visible light and UV-A radiation. [GB/T 12604.3-2013/ISO 12706.2009, definition 2.7] 3.3.7 Washable penetrant waterwashablepenetrant A penetrant that can be removed directly with water. [GB/T 12604.3-2013/ISO 12706.2009, definition 2.37] 3.3.8 Post-emulsified penetrant postemulsifiablepenetrant A penetrant that requires an emulsifier to be washed. It is an oil-based penetrant, which is divided into a post-emulsification type fluorescent penetrant and a post-emulsification type. Penetrant. 3.3.9 Solvent removal type penetrant solventremovablepenetrant Remove excess penetrant from the surface to be tested with a suitable solvent. 3.3.10 Emulsifier emulsifier The post-emulsified penetrant is made into a washable product. [GB/T 12604.3-2013/ISO 12706.2009, definition 2.10] 3.3.11 Hydrophilic emulsifier A remover that can be diluted with water. 3.3.12 Lipophilic emulsifier lipophilicemulsifier Oil based emulsifier. 3.3.13 Cleaning agent removeremover A volatile solvent that dissolves the permeate to remove excess penetrant from the surface of the workpiece being inspected. 3.3.14 Imaging developer It has the property of sufficiently aspirating the discontinuous internal penetrant to make it easier to observe the product of the penetrant. [GB/T 12604.3-2013/ISO 12706.2009, definition 2.4] 3.3.15 Dry powder imaging agent drydeveloper A fine dry powder imaging agent used primarily for fluorescence penetration. [GB/T 12604.3-2013/ISO 12706.2009, definition 2.6] 3.3.16 Liquid film developer liquidfilmdeveloper A suspension of imaging agents. After drying, a film of a resin or polymer is formed. 3.3.17 Soluble imaging agent solubledeveloper A non-suspended, fully soluble imaging agent in a solvent. After drying, a layer of adsorption coating is formed. 3.3.18 Suspension developer developerdeveloper An aqueous or non-aqueous suspension of developer particles. 3.3.19 Wetting agent wettingagent A substance added to a liquid to reduce its surface tension. 3.3.20 Ultraviolet radiation meter < Fluorescence Penetration Detection, Magnetic Particle Detection> An apparatus for measuring the intensity of black light. 3.3.21 Test block testpanel Specimens with known manual discontinuities for. --- determine and/or compare the sensitivity of the penetration detection process; or --- Regularly check the osmotic device. [GB/T 12604.3-2013/ISO 12706.2009, definition 2.31] 3.4 Performance parameters 3.4.1 Black light intensity blacklightintensity The black light energy that reaches the unit area per unit time is expressed by the irradiance at a certain distance from the light source. 3.4.2 Rest time dweltime The total time the penetrant or emulsifier is in contact with the surface of the test piece. Includes application time and purge time. 3.4.3 Clear time draintime The time to remove excess penetrant or emulsifier from the part. It is part of the rest time. 3.4.4 Emulsification time emulsificationtime The time during which the emulsifier is combined with the permeate on the surface of the test piece before the penetrant is discharged. 3.4.5 Drying time dryingtime The time required to allow the rinsing or wet display of the test piece to dry. 3.4.6 Development time From the application of the imaging agent to the time of starting the observation. [GB/T 12604.3-2013/ISO 12706.2009, definition 2.5]

4 magnetic particle testing

4.1 Basic terms 4.1.1 Leakage magnetic field After the magnetization of the ferromagnetic material, the magnetic field formed by the magnetic induction line leaving and entering the surface at the discontinuity or the change in the cross section of the magnetic circuit. [GB/T 12604.5-2008, definition 2.57] 4.1.2 Magnetic particle detection The magnetic powder shows the distribution of the leakage magnetic field of the ferromagnetic material, thereby discovering a non-destructive test of the surface or near surface defects of the material. technology. 4.1.3 Fluorescent magnetic particle detection fluorescentmagneticparticleflawtesting The use of fluorescent magnetic powder to inspect the surface and near surface defects of the material under black light. 4.1.4 Magnetic permeability The ratio of the magnetic induction intensity to the intensity of the external magnetic field that produces magnetic induction is commonly expressed by a symbol. 4.1.5 Ferromagnetic material A material whose relative magnetic permeability is much larger than 1, and whose magnetic permeability changes with an applied magnetic field. Among these materials are iron, nickel, cobalt and their alloy. 4.1.6 Hysteresis hysteresis When the direction of the external magnetic field changes, the change in the magnetic induction strength lags behind the change in the magnetic field strength. [GB/T 12604.5-2008, definition 2.65] 4.1.7 Magnetic saturation The degree of magnetization of a particular material, after saturation, does not increase the magnetic induction even if the magnetic field strength is increased. [GB/T 1264.5-2008, definition 2.94] 4.1.8 Remanent residualmagnetism The residual magnetic field in the ferromagnetic material when the applied magnetic field strength drops to zero. [GB/T 12604.5-2008, definition 2.119] 4.1.9 Magnetizing current The test piece is made to generate a magnetic current. Generally includes alternating current, direct current, half-wave rectified current, full-wave rectified current, pulse current, and Inrush current, etc. 4.1.10 Magnetized magnetizing The process of making a material that is not magnetically magnetic, or a process in which a single magnetic domain of a material is aligned in one direction. [GB/T 1264.5-2008, definition 2.97] 4.1.11 Circumferential magnetization The current flows directly through the workpiece or through the center conductor, creating a circumferential closure in the workpiece that surrounds the workpiece and is perpendicular to the long axis of the workpiece. The magnetization of the magnetic field. [GB/T 12604.5-2008, definition 2.16] 4.1.12 Longitudinal magnetization longitudinalmagnetization The magnetic flux passing through the object to be inspected is traversed by a magnetic flux whose direction is substantially parallel to the longitudinal axis of the object to be inspected. [GB/T 12604.5-2008, definition 2.76] 4.1.13 Composite magnetization The magnetization of the longitudinal and circumferential magnetic fields is simultaneously introduced. 4.1.14 Local magnetization localmagnetization Magnetize a part of the ferromagnetic material or component. 4.1.15 Multidirectional magnetization The test piece is magnetized in rapid succession by two or more magnetic fields in different directions. [GB/T 12604.5-2008, definition 2.102] 4.1.16 Rotating magnetic field rotationmagneticfield The magnetic field strength vector has a circular, elliptical or spiral magnetic field with time. 4.1.17 Tangential magnetic field strength tangentialmagneticfieldstrength A component of the magnetic field strength parallel to the surface of the workpiece being inspected. [GB/T 12604.5-2008, definition 2.128] 4.1.18 Magnetic particle An image formed by the accumulation of magnetic powder at a leakage magnetic field caused by defects and other factors. 4.1.19 Demagnetization The magnetization of the ferromagnetic material or the remanence on the workpiece is reduced to an acceptable level. [GB/T 12604.5-2008, definition 2.35] 4.2 Testing equipment 4.2.1 Magnetic particle flaw detector magneticparticleflawdetector A flaw detector that provides the required magnetizing current or flux for magnetic particle inspection. Divided into fixed, mobile, portable and other types. 4.2.2 Fluorescent magnetic particle flaw detector fluorescentmagnetic particleflawdetector A magnetic particle flaw detector equipped with a fluorescent magnetic powder and a black light irradiation device. 4.2.3 Stationary magnetic particle flaw detector stationarymagneticparticleflawdetector It can easily hold various parts of different sizes, and can easily adjust and indicate the magnetization current fixed in a certain place. Powder flaw detector. Generally, it includes a magnetizing power source, a clamping device, a magnetic powder spraying device, an observation device, a demagnetizing device, and the like. 4.2.4 Mobile magnetic particle flaw detector mobilemagneticparticleflawdetector A magnetic powder flaw detector that is mounted on a small wheel or a trolley to facilitate movement within a certain range. 4.2.5 Portable magnetic particle flaw detector portablemagneticparticleflawdetector A magnetic particle flaw detector that is small in size and light in weight and easy to handle. Generally only composed of magnetized power supply, flexible cable and pole contacts. According to magnetization The types of power sources can be further divided into electromagnetic yoke flaw detectors, permanent magnet flaw detectors, and rotating magnetic field flaw detectors. 4.3 Parts, Accessories and Materials 4.3.1 [magnetization] collet [magnetizing] contacthead A device for holding and supporting a workpiece to be inspected, and capable of introducing magnetizing current and/or forming a magnetic circuit. 4.3.2 Contact pad contactpad A copper wire preparation placed on the electrode to improve electrical contact and prevent arc burns of the test piece. 4.3.3 [strut] contact prods A hand-held rod electrode used to introduce a magnetizing current from a power source into a test piece mounted on a flexible cable. 4.3.4 Magnetizing coil magnetizingcoil A coil assembly that magnetizes a workpiece. 4.3.5 Open loop coil splitcoil Single or multi-turn coil assembly with plug connector. It can be separated and fastened for magnetized parts without free ends. 4.3.6 Magnetization power supply timesupply A power supply device that supplies magnetizing current in magnetic particle inspection. Can be divided into AC, DC, half-wave rectification, full-wave rectification, pulse current, etc. Types of. 4.3.7 Demagnetizer demagnetizer < Magneti......

Image

Tips & Frequently Asked Questions:

Question 1: How long will the true-PDF of GB/T 36416.2-2018_English be delivered?

Answer: Upon your order, we will start to translate GB/T 36416.2-2018_English as soon as possible, and keep you informed of the progress. The lead time is typically 6 ~ 10 working days. The lengthier the document the longer the lead time.

Question 2: Can I share the purchased PDF of GB/T 36416.2-2018_English with my colleagues?

Answer: Yes. The purchased PDF of GB/T 36416.2-2018_English will be deemed to be sold to your employer/organization who actually pays for it, including your colleagues and your employer's intranet.

Question 3: Does the price include tax/VAT?

Answer: Yes. Our tax invoice, downloaded/delivered in 9 seconds, includes all tax/VAT and complies with 100+ countries' tax regulations (tax exempted in 100+ countries) -- See Avoidance of Double Taxation Agreements (DTAs): List of DTAs signed between Singapore and 100+ countries

Question 4: Do you accept my currency other than USD?

Answer: Yes. If you need your currency to be printed on the invoice, please write an email to Sales@ChineseStandard.net. In 2 working-hours, we will create a special link for you to pay in any currencies. Otherwise, follow the normal steps: Add to Cart -- Checkout -- Select your currency to pay.